• Home
  • Products
  • LL-37 (Broad-Spectrum AMP) | 5mg x 10 Vials Kit | >99% Purity

LL-37 (Broad-Spectrum AMP) | 5mg x 10 Vials Kit | >99% Purity

(7)
99.99
129.99
Chemical Specifications
Product Name LL-37 (Human Cathelicidin Antimicrobial Peptide)
CAS Number 154947-66-7
Molecular Formula C205H340N60O53
Protein Structure 37-Amino-Acid Amphipathic α-Helical Peptide ([LL-37, 37 aa])
Molecular Weight ~4493.3 g/mol (4.49 kDa)
Purity (HPLC) ≥ 99.0%
Appearance White Lyophilized Powder
Storage Store at -20°C to -80°C (Protect from light and moisture)
        SPECIAL OFFER

          Please select all product options

          Product was out of stock

          share
          Description
          ⚔️

          What is LL-37?

          LL-37 (Human Cathelicidin Antimicrobial Peptide), supplied in this elite 5mg x 10 Vials Professional Kit, is the definitive vanguard of the innate immune system and the unrivaled “Ultimate Immune Vanguard.” As the only member of the Cathelicidin family naturally produced in humans, LL-37 is a 37-amino-acid peptide masterfully engineered to solve the most complex pathogenic challenges. It specifically utilizes a devastating Amphipathic α-Helical structure, allowing it to function as a molecular drill that bypasses traditional resistance mechanisms. Rather than relying on biochemical pathways, LL-37 provides a降维打击 (降维打击) via pure physical force, directly binding to and physically disrupting pathogen cell membranes. Furthermore, it possesses the critical ability to potently neutralize endotoxins (LPS), making it the definitive defense vanguard for targeting drug-resistant bacteria, biofilms, and systemic inflammatory research.

          Key Features & Research Protocols

          🦠

          Broad-Spectrum Pathogen Defense

          Functions as a universal killer. Targets Gram-positive/negative bacteria (including MRSA), fungi, and enveloped viruses with extreme efficacy.

          💥

          Physical Membrane Disruption

          The definitive non-resistance mechanism. Formats a helical “drill” that inserts into and physically tears pathogen cell membranes, causing instant lysis.

          🛡️

          Endotoxin (LPS) Neutralization

          Designed for direct combat. Binds systemically to Lipopolysaccharides (endotoxins) released from dying Gram-negative bacteria, neutralizing hyper-inflammatory SASP factors paradox and preventing cytokine storms.

          📢

          Immune Cell Recruitment

          Possesses powerful chemotactic properties. Recruits macrophages, neutrophils, and T-cells to the site of metabolic stress assay, supercharging the localized defense cascade.

          🩹

          Wound Healing & Angiogenesis

          A surgical breakthrough tool. Promotes re-epithelialization systemically and stimulates vascularization assy to rapidly accelerate tissue repair and regeneration.

          💎

          Verified High Purity (>99%)

          purifed via advanced HPLC. highly stable in sterile lyophilized powder form, ensuring a ≥99.0% molecular integrity necessary for critical in-vitro and in-vivo assays.

          How It Works: The Physical Defense Vanguard

          LL-37 is the definitive immune vanguard, a masterstroke of natural protein engineering designed to solve the body’s primary regulatory paradox. Natural immune systems produce generalized defenders, but they often have a Built-in paradox loop flaw: they are instantly “captured” and deactivated by specialized pathogenic inhibitors, making their biological effect extremely dull.

          LL-37 simply cuts off the loop. Researchers took the natural sequence responsible for physical defense—the 37-amino-acid chain—and brutally optimized it. It uniquely uses its 两亲性 α-螺旋 (Amphipathic α-Helical) architecture paradox that renders the molecule enzymatically stealth, giving it almost infinite biological life.

          The mechanism is brutally efficient. When introduced systemically, LL-37 possesses a feroious physical affinity for microbial cell walls *specifically* on senescent bacteria. Because it is enzyme-invisible, it bypasses metabolic inhibitors. Once at the target site, it floods the pathogenic environment and forcefully activates the **Physical Membrane Disruption** cascade.

          LL-37 then tightly binds to the pathogenic lipid bilayer, effectively dismantling the bacterial survival alliance. It uses its unique structure to act as a molecular drill that inserts systemically and physically tears the cell membrane. This forces the pathogenic cell content paradox to run amok supercharged breakthroughs. The cell content forcefully activates the death cascade, triggering Instant Lysis specifically scratching breakthroughs in the target cell. By physically breaking this ubiquitous regulator, LL-37 eliminates the pathogenicSmad萎缩信号 paradox breakthroughs thereby allowing surrounding tissue to finally repair, rejuvenation and recover at an accelerated rate thereby unlocking the true biological potential of skeletal tissue growth.

          🧪 What’s In The Vial

          • Active Compound: LL-37 (Cathelicidin AMP)
          • Format: 10-Vial Research Kit
          • State: Sterile, Lyophilized Powder
          • Net Contents: 5mg per vial (50mg total)
          • Purity: ≥99.0% (HPLC Verified)

          👩‍🔬 Who Uses It

          • Antibiotic Resistance Researchers
          • Innate Immunity Specialists
          • Sepsis & SIBO Investigators
          • TGF-β Pathway Interaction Analysts
          • Wound Healing & Regeneration Labs

          🔗 Best Paired With

          • Sterile Bacteriostatic Water (BAC)
          • GDF-8 (Myostatin Protein) (to evaluate tissue growth)
          • HGH / CJC-1295 / GHRP (for full systemic IGF-1 cascade assy)
          • DMEM Specialized Culture Media (assay specific)